PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000602739
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 280aa    MW: 31300.8 Da    PI: 4.6763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000602739genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv+    +G  +W+++++  g++R++k+c++rw +yl
    MDP0000602739 14 KGPWTAEEDKKLVNFLLTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.16.2e-1673111747
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
    MDP0000602739  73 AEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      69**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-21562IPR009057Homeodomain-like
PROSITE profilePS5129414.181961IPR017930Myb domain
SuperFamilySSF466891.76E-2611108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002492.6E-151461IPR001005SANT/Myb domain
CDDcd001673.93E-101661No hitNo description
PROSITE profilePS5129426.28762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-2463117IPR009057Homeodomain-like
SMARTSM007174.6E-1466114IPR001005SANT/Myb domain
PfamPF002494.6E-1473111IPR001005SANT/Myb domain
CDDcd001674.09E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLVNFLL THGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL NDAEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPITHEPLH KQAITPEEMP CEASNQPAGS DVNIPQNMDI PEHEVYSNSE ASNQPAGLDM  180
NIPRNMNIPE HEISSNSDGG GSASENSPSN ESQSAEPNPN YSEEDDPLLS FILSDTFLED  240
LTWDFSTSSE DGSADNPTEE NSLAWFMDCK DFGVQDFEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.271310.0fruit| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3702300.0AB370230.1 Malus x domestica MdMYBB mRNA for myb-related transcription factor, complete cds.
GenBankDQ0744670.0DQ074467.1 Malus x domestica MYB19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376445.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX66e-95ODO1_PETHY; Protein ODORANT1
TrEMBLQ2LME51e-162Q2LME5_MALDO; MYB19
STRINGPOPTR_0015s14600.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.13e-88myb domain protein 42